PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G03780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 441aa    MW: 50266.5 Da    PI: 6.3917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G03780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-18144190148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +lv++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  LPERR06G03780.1 144 KGQWTMEEDRKLVKLVEQFGLRKWSHIAQMLP-GRVGKQCRERWHNHL 190
                      799*****************************.*************97 PP

2Myb_DNA-binding51.81.9e-16196238145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W+++Ed+ l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  LPERR06G03780.1 196 KDTWSEDEDKVLIQTHKEVGNK-WAEIAKHLP-GRTENSIKNHWN 238
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.127139194IPR017930Myb domain
SuperFamilySSF466891.22E-31141237IPR009057Homeodomain-like
SMARTSM007173.4E-15143192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-28145197IPR009057Homeodomain-like
PfamPF139213.6E-19147205No hitNo description
CDDcd001674.70E-15147190No hitNo description
PROSITE profilePS5129420.793195245IPR017930Myb domain
SMARTSM007171.5E-15195243IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-21198243IPR009057Homeodomain-like
CDDcd001671.98E-12198241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MDFSCFQPHS AGCDDMPFDS YLQQNVHQEL HLVDHPFEGV SHGHEYYSPS AGESIHLPFA  60
TYYDLGHEYY YPQGGDKEAV IVDRSLPIMH KASPHQPLFT PKSEVSHLIG GSVVGSYKAF  120
EMNARLIRRK RASGKSLKKA NVVKGQWTME EDRKLVKLVE QFGLRKWSHI AQMLPGRVGK  180
QCRERWHNHL RPNIKKDTWS EDEDKVLIQT HKEVGNKWAE IAKHLPGRTE NSIKNHWNAT  240
KRRQFARRRS RASSKNPKSG TLLQNYIKSL GIGPIKASVR LAPPEPTVSS SPAPSTQNVN  300
SDKRPDSNPI NQMVTQGMLN MDENNYIQAN SCEELLVSSY DDLCLDMCDH LFETKEVTPY  360
QVYNIDDDVD MNYIFNDIDY ADKIGHEIDM EMAWEDDVLE DNETGSSTLE IPAGLVHINT  420
VHVKEEMDLV EMVTRTQSCG K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-441422452105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-441422452105C-Myb DNA-Binding Domain
1msf_C6e-441422452105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418120.0AK241812.1 Oryza sativa Japonica Group cDNA, clone: J065210K15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641269.10.0PREDICTED: myb-related protein A isoform X1
TrEMBLA0A0D9WM800.0A0A0D9WM80_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022369-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.18e-65myb domain protein 98